Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01076

ProSeqID PSQ01076
Family FD00007
Protein Name Kallikrein 1-related peptidase b22
UniProt ID P15948
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Mammalia-Eutheria-Euarchontoglires-Glires-Rodentia-Myomorpha-Muroidea-Muridae-Murinae-Mus-Mus
Organisms Mus musculus (Mouse)
Prosequence Length (aa) 7
Functions endopeptidase activity, hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides, peptidase activity, serine-type endopeptidase activity
Preproprotein Length (aa) 259
Alt Name Beta-NGF-endopeptidase, Epidermal growth factor-binding protein type A, Glandular kallikrein K22, Nerve growth factor beta chain endopeptidase, Tissue kallikrein 22
Gene Name Klk1b22
NCBI ID 10090
Cellular Localization extracellular space, protein-containing complex, secretory granule
Processes regulation of systemic arterial blood pressure, zymogen activation
PubMed 1639762, 2012805
Total Prosequence Length (aa) 7
Prosequence Location 18:24
Prosequence Sequence APPVQSR
Preproprotein Sequence MRFLILFLTLSLGGIDAAPPVQSRILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP