Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ01074

ProSeqID PSQ01074
Family FD00360
Protein Name Photosystem II reaction center protein K
UniProt ID P15819
Taxonomy Bacteria-Cyanobacteria-Synechococcales-Merismopediaceae-Synechocystis-Unclassified-Synechocystis
Organisms Synechocystis sp
Prosequence Length (aa) 8
Functions None
Preproprotein Length (aa) 45
Alt Name None
Gene Name psbK
NCBI ID 1111708
Cellular Localization integral component of membrane, photosystem II reaction center, plasma membrane-derived thylakoid membrane, plasma membrane-derived thylakoid photosystem II
Processes photosynthesis
PubMed 12069591, 1904061
Total Prosequence Length (aa) 8
Prosequence Location 1:8
Prosequence Sequence METIYLLA
Preproprotein Sequence METIYLLAKLPEAYQIFDPLVDVLPVIPLFFLALAFVWQAAVGFK