Details of PSQ00965
| ProSeqID |
PSQ00965 |
| Family |
FND00020 |
| Protein Name |
U-actitoxin-Avd9b |
| UniProt ID |
P0DN01
|
| Taxonomy |
Eukaryota-Metazoa-Cnidaria-Anthozoa-Hexacorallia-Actiniaria-Actiniidae-Anemonia |
| Organisms |
Anemonia viridis (Snakelocks anemone) |
| Prosequence Length (aa) |
19 |
| Functions |
toxin activity |
| Preproprotein Length (aa) |
80 |
| Alt Name |
Potassium channel toxin avtx-7 |
| Gene Name |
None |
| NCBI ID |
51769 |
| Cellular Localization |
extracellular region, nematocyst |
| Processes |
None |
| PubMed |
21281459
|
| Total Prosequence Length (aa) |
19 |
| Prosequence Location |
21:39 |
| Prosequence Sequence |
ERRGTETGGYKKDTLQDLK |
| Preproprotein Sequence |
MNLKVLAVFVLCAILVVVTAERRGTETGGYKKDTLQDLKKRTHDCFDRYREAACTSDNIRLLCKTSAKYQINCKKSCGLC |