Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00952

ProSeqID PSQ00952
Family FND00158
Protein Name Antimicrobial peptide HsAp1
UniProt ID P0DMI7
Taxonomy Eukaryota-Metazoa-Ecdysozoa-Arthropoda-Chelicerata-Arachnida-Scorpiones-Iurida-Scorpionoidea-Scorpionidae-Scorpioninae-Heterometrus
Organisms Heterometrus spinifer (Asia giant forest scorpion) (Malaysian black, scorpion)
Prosequence Length (aa) 6
Functions None
Preproprotein Length (aa) 74
Alt Name Non-disulfide-bridged peptide 3
Gene Name None
NCBI ID 118530
Cellular Localization extracellular region, membrane, other organism cell membrane
Processes cytolysis, defense response to bacterium, defense response to fungus, killing of cells of other organism
PubMed 23000095
Total Prosequence Length (aa) 6
Prosequence Location 69:74
Prosequence Sequence AISEQT
Preproprotein Sequence MSRRVILTLVLVTILVKTMAGMESKKVETTDEIKKRSGTSEKERESGRLLGVVKRLIVCFRSPFPGRRAISEQT