Details of PSQ00943
| ProSeqID |
PSQ00943 |
| Family |
FD00006 |
| Protein Name |
Alpha-conotoxin TxIA |
| UniProt ID |
P0DM21
|
| Taxonomy |
Eukaryota-Metazoa-Spiralia-Lophotrochozoa-Mollusca-Gastropoda-Caenogastropoda-Neogastropoda-Conoidea-Conidae-Conus-Cylinder |
| Organisms |
Conus textile (Cloth-of-gold cone) |
| Prosequence Length (aa) |
23 |
| Functions |
acetylcholine receptor inhibitor activity, toxin activity |
| Preproprotein Length (aa) |
60 |
| Alt Name |
Conotoxin tx1a |
| Gene Name |
None |
| NCBI ID |
6494 |
| Cellular Localization |
extracellular region, host cell postsynaptic membrane |
| Processes |
pathogenesis |
| PubMed |
17660751
|
| Total Prosequence Length (aa) |
23 |
| Prosequence Location |
17:39 |
| Prosequence Sequence |
FTSDRASDDGKAAASDLITLTIK |
| Preproprotein Sequence |
MFTVFLLVVLATAVVSFTSDRASDDGKAAASDLITLTIKGCCSRPPCIANNPDLCG |