Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00654

ProSeqID PSQ00654
Family FND00311
Protein Name Antimicrobial peptide lumbricin-1
UniProt ID O96447
Taxonomy Eukaryota-Metazoa-Spiralia-Lophotrochozoa-Annelida-Clitellata-Oligochaeta-Haplotaxida-Lumbricina-Lumbricidae-Lumbricinae-Lumbricus
Organisms Lumbricus rubellus (Humus earthworm)
Prosequence Length (aa) 14
Functions None
Preproprotein Length (aa) 76
Alt Name None
Gene Name None
NCBI ID 35632
Cellular Localization None
Processes defense response to bacterium, defense response to fungus, killing of cells of other organism
PubMed 9784609
Total Prosequence Length (aa) 14
Prosequence Location 1:14
Prosequence Sequence MSLCISDYLYLTLT
Preproprotein Sequence MSLCISDYLYLTLTFSKYERQKDKRPYSERKNQYTGPQFLYPPERIPPQKVIKWNEEGLPIYEIPGEGGHAEPAAA