Details of PSQ00619
| ProSeqID |
PSQ00619 |
| Family |
FD00036 |
| Protein Name |
Lantibiotic mutacin-2 |
| UniProt ID |
O54329
|
| Taxonomy |
Bacteria-Firmicutes-Bacilli-Lactobacillales-Streptococcaceae-Streptococcus |
| Organisms |
Streptococcus mutans |
| Prosequence Length (aa) |
26 |
| Functions |
signaling receptor binding |
| Preproprotein Length (aa) |
60 |
| Alt Name |
Lantibiotic mutacin H-29B, Mutacin II |
| Gene Name |
mutA |
| NCBI ID |
1309 |
| Cellular Localization |
extracellular region |
| Processes |
amino acid transport, cytolysis, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, regulation of membrane potential |
| PubMed |
10821848,
16626493,
8021218,
9647795
|
| Total Prosequence Length (aa) |
26 |
| Prosequence Location |
1:26 |
| Prosequence Sequence |
MNKLNSNAVVSLNEVSDSELDTILGG |
| Preproprotein Sequence |
MNKLNSNAVVSLNEVSDSELDTILGGNRWWQGVVPTVSYECRMNSWQHVFTCC |