Details of PSQ00609
| ProSeqID |
PSQ00609 |
| Family |
FD00376 |
| Protein Name |
Sporulation killing factor |
| UniProt ID |
O31422
|
| Taxonomy |
Bacteria-Firmicutes-Bacilli-Bacillales-Bacillaceae-Bacillus |
| Organisms |
Bacillus subtilis (strain 168) |
| Prosequence Length (aa) |
29 |
| Functions |
None |
| Preproprotein Length (aa) |
60 |
| Alt Name |
Sporulation-killing factor SkfA |
| Gene Name |
skfA |
| NCBI ID |
224308 |
| Cellular Localization |
extracellular region |
| Processes |
cytolysis, defense response to bacterium |
| PubMed |
20805502
|
| Total Prosequence Length (aa) |
29 |
| Prosequence Location |
1:29 |
| Prosequence Sequence |
MKRNQKEWESVSKKGLMKPGGTSIVKAAG |
| Preproprotein Sequence |
MKRNQKEWESVSKKGLMKPGGTSIVKAAGCMGCWASKSIAMTRVCALPHPAMRAI |