Details of PSQ00514
| ProSeqID |
PSQ00514 |
| Family |
FND00021 |
| Protein Name |
Brevinin-2ISc |
| UniProt ID |
F1T155
|
| Taxonomy |
Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Amphibia-Batrachia-Anura-Neobatrachia-Ranoidea-Ranidae-Odorrana |
| Organisms |
Odorrana ishikawae (Ishikawa |
| Prosequence Length (aa) |
18 |
| Functions |
None |
| Preproprotein Length (aa) |
75 |
| Alt Name |
None |
| Gene Name |
None |
| NCBI ID |
310659 |
| Cellular Localization |
None |
| Processes |
defense response to Gram-negative bacterium, defense response to Gram-positive bacterium |
| PubMed |
21193000
|
| Total Prosequence Length (aa) |
18 |
| Prosequence Location |
23:40 |
| Prosequence Sequence |
EEERDADEDEGEMTEEEV |
| Preproprotein Sequence |
MFTLKKSLLLLFFLGTISLSLCEEERDADEDEGEMTEEEVKRSVLGTVKDLLIGAGKSAAQSVLTTLSCKLSNSC |