Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00509

ProSeqID PSQ00509
Family FND00039
Protein Name Esculentin-1ISb
UniProt ID F1T150
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Amphibia-Batrachia-Anura-Neobatrachia-Ranoidea-Ranidae-Odorrana
Organisms Odorrana ishikawae (Ishikawa
Prosequence Length (aa) 14
Functions None
Preproprotein Length (aa) 84
Alt Name None
Gene Name None
NCBI ID 310659
Cellular Localization extracellular region
Processes defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium, killing of cells of other organism
PubMed 21193000
Total Prosequence Length (aa) 14
Prosequence Location 23:36
Prosequence Sequence EQERAADEDEGTKI
Preproprotein Sequence MFTLKKPLLLIVLLGIISLSLCEQERAADEDEGTKIKRRIFSKIGGKAIKNLILKGIKNIGKEVGMDVIRTGIDVAGCKIKGEC