Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00508

ProSeqID PSQ00508
Family FND00039
Protein Name Esculentin-1SIa
UniProt ID F1T149
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Amphibia-Batrachia-Anura-Neobatrachia-Ranoidea-Ranidae-Odorrana
Organisms Odorrana ishikawae (Ishikawa
Prosequence Length (aa) 14
Functions None
Preproprotein Length (aa) 84
Alt Name None
Gene Name None
NCBI ID 310659
Cellular Localization extracellular region
Processes defense response to fungus, defense response to Gram-negative bacterium, defense response to Gram-positive bacterium
PubMed 21193000
Total Prosequence Length (aa) 14
Prosequence Location 23:36
Prosequence Sequence EQERAADEDEGSEI
Preproprotein Sequence MFTLKKPLLLIVLLGIISLSLCEQERAADEDEGSEIKRGIFSKFAGKGIKNLLVKGVKNIGKEVGMDVIRTGIDIAGCKIKGEC