Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00458

ProSeqID PSQ00458
Family FD00002
Protein Name Esculentin-2MT2
UniProt ID E1B242
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Amphibia-Batrachia-Anura-Neobatrachia-Ranoidea-Ranidae-Amolops
Organisms Amolops mantzorum (Sichuan torrent frog)
Prosequence Length (aa) 15
Functions None
Preproprotein Length (aa) 76
Alt Name None
Gene Name None
NCBI ID 167930
Cellular Localization extracellular region
Processes defense response to bacterium, defense response to fungus, hemolysis in other organism
PubMed 24601776
Total Prosequence Length (aa) 15
Prosequence Location 23:37
Prosequence Sequence EEERSADEDDGEKEV
Preproprotein Sequence MFTLKKSMLLLFFLGTISLSLCEEERSADEDDGEKEVKRGIFSLIKTAAKFVGKNLLKQAGKAGMEHLACKANNQC