Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00454

ProSeqID PSQ00454
Family FD00002
Protein Name Esculentin-2CG1
UniProt ID E1B230
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Amphibia-Batrachia-Anura-Neobatrachia-Ranoidea-Ranidae-Amolops
Organisms Amolops chunganensis (Chungan torrent frog) (Hylorana chunganensis)
Prosequence Length (aa) 15
Functions None
Preproprotein Length (aa) 76
Alt Name None
Gene Name None
NCBI ID 325556
Cellular Localization extracellular region
Processes defense response to bacterium, defense response to fungus, hemolysis in other organism
PubMed 22951323
Total Prosequence Length (aa) 15
Prosequence Location 23:37
Prosequence Sequence EEERSADEDDGEEEV
Preproprotein Sequence MFTMKKSMLLLFFLGTISLSLCEEERSADEDDGEEEVKRSLFSIFKTAAKFVGKNLLKQAGKAGLETLACKAKNEC