Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00309

ProSeqID PSQ00309
Family FD00002
Protein Name Esculentin-2-ALb
UniProt ID C5H0D5
Taxonomy Eukaryota-Metazoa-Chordata-Craniata-Vertebrata-Euteleostomi-Amphibia-Batrachia-Anura-Neobatrachia-Ranoidea-Ranidae-Amolops
Organisms Amolops loloensis (Lolokou Sucker Frog) (Staurois loloensis)
Prosequence Length (aa) 17
Functions None
Preproprotein Length (aa) 76
Alt Name Amolopin-9b
Gene Name None
NCBI ID 318551
Cellular Localization extracellular region
Processes defense response to bacterium, defense response to fungus, innate immune response, killing of cells of other organism
PubMed 19843479
Total Prosequence Length (aa) 17
Prosequence Location 23:39
Prosequence Sequence EEERSADEDDGEKGVKR
Preproprotein Sequence MFTMKKSLLLLFFLGTISLSLCEEERSADEDDGEKGVKRGIFSLIKTAAKFVGKNLLKQAGKAGVEHLACKANNQC