Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00064

ProSeqID PSQ00064
Family FD00097
Protein Name Morintide mO1
UniProt ID A0A1S6EK91
Taxonomy Eukaryota-Viridiplantae-Streptophyta-Embryophyta-Tracheophyta-Spermatophyta-Magnoliopsida-Eudicotyledons-Gunneridae-Pentapetalae-Rosids-Malvids-Brassicales-Moringaceae-Moringa
Organisms Moringa oleifera (Horseradish tree) (Moringa pterygosperma)
Prosequence Length (aa) 16
Functions chitin binding, ribonuclease activity
Preproprotein Length (aa) 79
Alt Name 8C-hevein-like protein
Gene Name None
NCBI ID 3735
Cellular Localization None
Processes defense response to fungus, killing of cells of other organism
PubMed 28359256
Total Prosequence Length (aa) 16
Prosequence Location 64:79
Prosequence Sequence GGGADGAGGEAGGGGP
Preproprotein Sequence MAKLSFLSLFLLCLVATATAQNCGRQAGNRACANQLCCSQYGFCGSTSEYCSRANGCQSNCRGGGGADGAGGEAGGGGP