Home Advance Search BLAST Contact Documentation/Help Feedback

Details of PSQ00060

ProSeqID PSQ00060
Family FND00069
Protein Name Potassium channel toxin alpha-KTx 8
UniProt ID A0A1L2FZD4
Taxonomy Eukaryota-Metazoa-Ecdysozoa-Arthropoda-Chelicerata-Arachnida-Scorpiones-Buthida-Buthoidea-Buthidae-Orthochirus
Organisms Orthochirus scrobiculosus (Central Asian scorpion)
Prosequence Length (aa) 9
Functions ion channel inhibitor activity, toxin activity
Preproprotein Length (aa) 60
Alt Name OSK3
Gene Name None
NCBI ID 6892
Cellular Localization extracellular region
Processes negative regulation of voltage-gated potassium channel activity in other organism, pathogenesis
PubMed 28179135
Total Prosequence Length (aa) 9
Prosequence Location 20:28
Prosequence Sequence IIPDSKVEV
Preproprotein Sequence MCRLYAIILIVLVMNVIMTIIPDSKVEVVSCEDCPEHCSTQKARAKCDNDKCVCEPI