Details of PSQ00036
| ProSeqID |
PSQ00036 |
| Family |
FND00074 |
| Protein Name |
Antimicrobial peptide AcrAP1 |
| UniProt ID |
A0A0A1I6E7
|
| Taxonomy |
Eukaryota-Metazoa-Ecdysozoa-Arthropoda-Chelicerata-Arachnida-Scorpiones-Buthida-Buthoidea-Buthidae-Androctonus |
| Organisms |
Androctonus crassicauda (Arabian fat-tailed scorpion) |
| Prosequence Length (aa) |
29 |
| Functions |
None |
| Preproprotein Length (aa) |
74 |
| Alt Name |
None |
| Gene Name |
None |
| NCBI ID |
122909 |
| Cellular Localization |
extracellular region, membrane, other organism cell membrane |
| Processes |
defense response to bacterium, defense response to fungus, killing of cells of other organism |
| PubMed |
25332684
|
| Total Prosequence Length (aa) |
29 |
| Prosequence Location |
46:74 |
| Prosequence Sequence |
DLDGQIDRFRNFRKRDAELEELLSKLPIY |
| Preproprotein Sequence |
MEIKYLLTVFLVLLIVSDHCQAFLFSLIPHAISGLISAFKGRRKRDLDGQIDRFRNFRKRDAELEELLSKLPIY |